CDS

Accession Number TCMCG023C05079
gbkey CDS
Protein Id PIN22156.1
Location 72663..72881
Organism Handroanthus impetiginosus
locus_tag CDL12_05136

Protein

Length 72aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA324125, BioSample:SAMN05195323
db_source NKXS01000820.1
Definition hypothetical protein CDL12_05136 [Handroanthus impetiginosus]
Locus_tag CDL12_05136

EGGNOG-MAPPER Annotation

COG_category J
Description Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit
KEGG_TC -
KEGG_Module M00178        [VIEW IN KEGG]
KEGG_Reaction -
KEGG_rclass -
BRITE br01610        [VIEW IN KEGG]
ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
ko03011        [VIEW IN KEGG]
KEGG_ko ko:K02887        [VIEW IN KEGG]
EC -
KEGG_Pathway ko03010        [VIEW IN KEGG]
map03010        [VIEW IN KEGG]
GOs GO:0000027        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003735        [VIEW IN EMBL-EBI]
GO:0005198        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009507        [VIEW IN EMBL-EBI]
GO:0009526        [VIEW IN EMBL-EBI]
GO:0009532        [VIEW IN EMBL-EBI]
GO:0009536        [VIEW IN EMBL-EBI]
GO:0009570        [VIEW IN EMBL-EBI]
GO:0009941        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0022607        [VIEW IN EMBL-EBI]
GO:0022613        [VIEW IN EMBL-EBI]
GO:0022618        [VIEW IN EMBL-EBI]
GO:0031967        [VIEW IN EMBL-EBI]
GO:0031975        [VIEW IN EMBL-EBI]
GO:0034622        [VIEW IN EMBL-EBI]
GO:0042254        [VIEW IN EMBL-EBI]
GO:0042255        [VIEW IN EMBL-EBI]
GO:0042273        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043933        [VIEW IN EMBL-EBI]
GO:0044085        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044434        [VIEW IN EMBL-EBI]
GO:0044435        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0065003        [VIEW IN EMBL-EBI]
GO:0070925        [VIEW IN EMBL-EBI]
GO:0071826        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGACCAGAACTAAACGCGAATATGTAGCCTGGAGACGTAGAACAAAAAGTCGTTTATGTGTATCAATTTTTCGAGGGGCGCATTCAAAACATACTCGAAATATTACTCAACAGAAAATAAGAGCTTTACTTTCGGCTCATCGGGATAGCGATAAGCAAAAGAGAAATTTTCGTCATTTGTGGATCACTCGGATAAATGCAGTAATTCGAGAAAGGTAG
Protein:  
MTRTKREYVAWRRRTKSRLCVSIFRGAHSKHTRNITQQKIRALLSAHRDSDKQKRNFRHLWITRINAVIRER